Pay in 4 interest-free payments of $131.35 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
Catalogue Number: DF15188
Catalogue Numbers: DF9586-100
Specificity: GPR115 Antibody detects endogenous levels of total GPR115
TUBGCP5 Antibody
The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1β and absent from SDF-1α
CD317 Recombinant Protein - NCP0356 Stem Cells Catalogue Number: DF15188CD317 Recombinant Protein Catalogue Number: NCP0356 500, NCP0356 1000 Sizes: 500ug, 1mg Swiss Prot: Q10589 Host: E. coli Tag: His tag AA Sequence: MNSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHt VMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS Restriction Sites: NdeI XhoI Background: BST2 (CD317, Tetherin, HM1. 24) is a type II transmembrane glycoprotein functioning as a major mediator of the innate immune defense against the
US$ 91.00
US$ 29.90
US$ 91.00
US$ 30.00